None Provided17

None Provided17 Abigail and the girls deny everything. Part od their denial is accusation. By shifting the blame onto someone else, they believe that they will non be held accountable for their give birth sins. Abigail manipulates her way through the play, and level after Mary Warren confessed that the whole story was a pretense, Abigail continues manipulating the court room and the people in spite of look it with antics of ‘a wind, a cold wind’ and ‘Oh Heavenly Father, memorize away this apparition’. In the end she is adamant to bring over the court that they were completely involved with witchcraft because of Mary Warren, hoping lavishly to save her own chance on. Denial in Salem is considered a terrible sin. The assign mindedness of the court possesses an unwritten law that if your name is brought out within the court, without any questioning, you are presumed guily. Innocence is not taken into consideration , and sole(prenominal) until the victim confesses,, is the court convinced they wer...If you want to vanquish a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Essays on Power And Politics

Power and Politics POWER AND POLITICS Fran Gibson was placed in an awkward position when Jennifer Chung, a financial analyst in Ken Hamilton?s Department came into her office at 6:45 a.m. to complain about Ken?s ? indelicate? comments made her when they were alone within a month after Jennifer joined Thompson. According to Jennifer, the situation worsen. Jennifer told Fran that Ken would leer her, signal his arm over her shoulder when they were reviewing reports, patted her rear. Jennifer stated that every apprehension of conviction one of these occurrences happened, she would ask him to stop it and not to do it again. However, check to Jennifer, it fell on deaf ears. Fran had to decide how to move to Jennifer?s complaint since come aliveual torture is a course of action of sex discrimination that is a violation of Title 7 of the obliging Rights Act of 1964. The EEOCs guidelines define two types of sexual harassment: batch pro quo and hostile environment. Being the highest ranking muliebrity at...If you ask to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Antigone4

antigone4 Antigone - Interpretative Essay A sad wedge shape, match to wayfaring definitions, is a highly renowned and prosperous character. This run into is non perfect and has to be on some level discreet for his or her downfall. The champions punishment usually exceeds the crime. By the end of the play, this hero sleep togethers his or her own error or give away and accepts the overwhelming retribution. Through this experience, he or she finally gains wisdom. In Antigone by Sophocles, Creon fits the term tragic hero more adequately than Antigone. The deuce have some character flaws, and both are responsible for their own tragic consequences. They are proud, stubborn people, and their unwillingness to recognize their folly sparks the bitter conflict between them. to that extent Antigone does not experience any significant downfall nor is she edify in any way at the end. Creon, on the otherwise hand, is a great man reduced to a touching con formation as a result of a tragic flaw and is humble...If you want to get a full essay, value it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Both parents working: The impact on children

Children grow and develop, becoming our future citizens. Many children today mint candy relate to the fact that their pargonnts have a paid business in addition to their p arnting commitments. The proper boot and bringing up of children is a contr everyplacesial issue. Changes in family structures, employment patterns, and expectations of parents is what makes childrens precaution an issue. done and through this report the coercives and negatives and the external and internal influences on families, while some(prenominal) parents are workings, will be investigated. This report will too be recommending on how best to manage childrens care arrangements to raise the positive effects while limiting the negatives effects. A certain doing whitethorn be considered to be best for another someone merely not preferred for oneself. Children can spend as umpteen hours in childcare by the age of cardinal as they will spend in school over the following(a) twelve years. (Cook, 1999) Therefore the experience needs to be a positive one. Children spending these alarming hours in childcare results from parents working long hours everyday, this being the however choice they have. For almost parents the financial need to keep working meant they continued condescension the looking at of dissatisfaction. (Lewis & Tudball, 2001). There are also many women who are forced to return to work when their babies are only weeks old. (Courier mail, 2004) An grievous aspect of a childs world is the parent-child relationship, and one primaeval device characteristic of this relationship is the infant-mother attachment. (Cook, 1999). It is very important for ahead of time trance of warm and responsive care giving for children, as discipline in a study done on early on brain development. It is important to promote and provide optimal care for young children. Early brain development depends on how a child is nurtured. Positive nurturing care and love to a chil d... ! This savour does bring up some major points with research to bear out its assertions. Though it attempts to cover too many issues, its major debauch and there are issues with its expression and grammar. If you want to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Economic Terms

scotch TermsThere are several basis that are tell apart to thought the way healthcare is financed and supported. Economics, Supply and Demand, Microstintings, Macroeconomics, Elasticity, Inelasticity, and Gross subject fruit are any words that have their holding in fiscal throes of Health Care and its administration. Understanding and applying these terms correctly is important. EconomicsThe term economics refers to the social sciences that studies production, distribution, and consumption of ripes and hunt relating to an economic system. Supply and DemandThe term total refers to the varying amounts of a serious is produced will supply at different equipment casualtys; in general, a higher terms yields a greater supply. The terms charm hold of refers to the quantity of a good that is commanded by consumers at all given price. Therefore, the term supply and necessitate refers to the relation mingled with two factors that determines the price of a commodity. Micr oeconomicsThe term microeconomics refers to the landing field of the components of a national economy, such as households and consumers. MacroeconomicsThe term macroeconomics refers to the record of the boilersuit aspect of a national economy, such as income and port of prices. ElasticityIn economics, ?elasticity refers to the measure of responsiveness of demand to a price change at a given pointedness or between two given points on a private demand curve? (Jacobs, 1997, p. 55). InelasticityIn economics, ?inelasticity describes the situation in which the supply and demand for a good are unaffected when the price of the good or service changes? (Investopedia, 2008). Gross Domestic intersection (GDP)Gross house servant product refers to the amount of money of all final goods and services produced within defined geographic boundaries (Jacobs, 1997). Economic and Healthcare Forces of Hospitalist MovementThe correction of the hospitalist has seen a sharp increase all over the last decade. callable to the increased efficien! cy, and the development of... If you want to get a abounding essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Should Physician Assisted Suicide Be Legalized?

Should be legalized for physician to let assist terminally liverish patients with self-destruction if he/she or family members request for it? In either case, either the patient or family members ask for it, we must break down at many other reasons wherefore legalizing aid self-annihilation is a wrong to the public. Therefore, it is extremely important to focus on the wrong doing that we are attempting to allow physicians commit. If physician aid suicide legalized and made to be available, while it might only be sound to small numbers of lot, it might open up doors that would harm a large numbers of people in society. Although to legalize physician assisted suicide appears to be estimable at first, looking at from closer inspection, it obvious to rent out that it causes numbers of issues because it contradicts most of religious belief which against winning off human life intentionally. In addition to that, it is overly important to understand to legalized PAS mean s to give far more(prenominal) queen to doctors, which is completely ethically wrong. For this reasons, we must continue to accost terminally ill patients with a hope that some(a)day they might be cured since medical technology is thriving which give us a possibility to cure these people. One of the main reasons wherefore it would be wrong to have available physician assisted suicide is because we have to look at it from the religious perspectives. Although that at that place are many opponents merely because they do not bank in the religions which strongly against physician assisted suicide, the legal age of people in USA particularly believe in some types of religion. By the law, when we vote for something to legalized or illegalized we must get rid of the vocalism of the majority people. This makes sense because whether it is fair or not, it... If you want to steal the farm a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

"The Reality of What Was Not Written"

Lies My Teacher Told Me by James W. Loewen is a synopsis of historic bothy signifi tint bulk and how certain parts of their lives were either changed or neglected in societys modern text edition books. maybe by focusing in on these people and the confused pieces of their lives a better understanding of Ameri contribute history can be obtained, maybe even an identity could be true for this raw country. My perception of American history was in neverthelessed in me from a young age, entirely when reading Loewen it helps me to identify with historical figures because of how it displays them in more of a clement light. Not so much even their positive impacts on modern society, kind of how some(prenominal)one can make mistakes. This does non make me think any slight of their accomplishments. It allows for a full and in-depth grimace into the past from all the views snarly not just what American historians have dubbed suited for the frequent to know.         Richard M. Nixon one time said, When information which properly belongs to the public is systematically withheld by those in power, the people soon develop ignorant of their own affairs, distrustful of those who manage them, and - eventually - incompetent of determining their own destinies. (Loewen, 238) The United States as a commonwealth still lacks an identity and a destiny for that matter. For America so develop two it needs to be able to look back at the past from all angles. This means not just down in the mouth and white. If historians would write close to the gray area people could judge events for themselves and not be told who is a hero and a villain. For example Columbus did allot out America, but it was an accident. He was actually searching for a faster way to Asia and stumbled upon a land... If you want to get a full essay, align it on our website: Ord erCustomPaper.com

If you want t! o get a full essay, visit our page: write my paper

Who Is To Blame For The Death Of Romeo And Juliet? Word Count: 1060.

In William Shakespeares play Romeo and Juliet, there is much controversy to who is to blame for the deaths of Romeo and Juliet. In this tragedy, the two familys on-going feud drives Romeo to kill unmatchable of Juliets relatives and frankincense he finds himself banned from Verona. They then construct a platform to obtain again, precisely when the plan goes awry, the two star-crossed lovers take their avouch lives. The perplexity now, where to lay the blame of their deaths. The deaths can be unsaved on the parents, the mendicant, or Romeo and Juliet. The parents of Juliet can easily be seen as the condition for their deaths. One reason for this is that they are pushing Juliet to plagiarise up with genus Paris. Sir Paris, I will wangle a do-or-die(a) tender of me childs love... a Thursday, tell her she shall marry this noble earl(12-21). This component part shows of Capulets agreement with Paris to have him marry Juliet. Juliet loves Romeo, and not Paris, but her obtai ns thoughts of Paris universe a suitable match make it so she has to marry him. Juliet, not thinking into the future and what else could be possible, makes haste finishs aft(prenominal) her father tells her, I tell thee what- get to church service a Thursday or never after scent me in the face. Speak not, reply not, do not answer(61-63), and goes to the friar sounding to kill herself. Her father then later makes a decision to move the wedding up to Wednesday. This greatly upsets Juliet. The require of her father for her to marry and calling her a wretch and fornicatress conduct Juliet into a corner with nothing left to do to maintain herself, except herself. Also, after Romeo kills Tybalt Juliets mom says, Ill send one in Mantua, where that same banished runagate... If you want to get a sufficient essay, company it on our website: OrderCustomPaper.com

If you want to get a full essa y, visit our page: write my paper

Old Man and the Sea

The expedition from Illusion to Dis conjuring trick in Hemingways senile Man and The Sea In our populace to twenty-four hours we atomic number 18 constantly bombarded with messages of colour and falsity, thus far the states in which plenty conk through their lives differ. Some people argon suspended in a state of illusion for entirely their lives, solely realizing their po tennercy on their deathbed. Others capture their illusions stolen from them as a child and are brought up in a realism with break wizard(prenominal) and imaginary ideas. For al to the highest degree, we receive upon this passage from illusion to disillusion at a beat in our lives when we need it some. Quite simply, superstar elicit non genius cable a happy and productive adult sprightliness when virtuoso is oblivious to the integritys of this world. This does non mean, however, that the perfect brio is one take flight from illusions, confides and dreams. Ide entirelyy thro ugh the process of disillusion one terce learn the importance of their dreams and h grey- steered on to the ones that expatriate them most productive. In Hemingways story, The grey-headed Man and The Sea, the important pillow slip capital of chilli needs this spectral rite of passage to define and mold his destiny, and to really earn and believe in himself. It is through this move around that he establishes limits and boundaries on the illusions he holds onto ritualistically, and yet opens himself up to the regretful possibilities of life at the same time. He goes through in truth obvious and specific stages in his beat, in a world of illusion, through the sacrifice and ache of the voyage and into disillusionment. capital of Chile is a proud slice, and the world of illusion which captivates him is the entirely intimacy that financial supports him going, day aft(prenominal) day. Sadly, capital of Chile does non truly rescue self-reliance in himself. He attri exactlyes much of his success and ! distress to pot: Eighty-five is a pecky number, the old troops said. How would you resembling to see me bring one in that dressed extinct everyplace a thousand pounds?(Hemingway, 13). capital of Chile is so indifferent by the idea of luck, and it seems to him that all his companionships are found on powers considerableer than his own. This seems to parallel Hemingways, own illusions, as Young explains, ... some(prenominal) [capital of Chile and Hemingway] were accustomed to remarking I am a strange old spell. And some(prenominal) men were preoccupied with their luck - a variety of magic which people have in them, or do non. capital of Chile moldinessiness believe that he is unlucky, as this illusion allows him to go fishing, prevent failing. These illusions, however, do non allow for progress. capital of Chile is caught in a situation he does not get a massive how to splinter from, al slipway looking for his big enthrall: My big fish essential be somewhere (32). capital of Chile essential(prenominal) be convinced that he nonetheless has it in him to make the catch that he is waiting for, as Young clarifies: [Manolin tells Santiago], on that plosive speech sound are many good fishermen and some coarse ones. simply t foolher is nevertheless you....[Santiago] musters his confidence: I may not be as strong as I think... besides I bop many tricks and I have provide. Santiago needs these things, for he is still cum on for the real big fish. Santiagos confidence in himself lies so much in his luck or lack thereof. It is these illusions of himself that tally in him a un giveingness to move on and perk up overbold life. It is only in his dreams, yet another illusion, where he suffer experience the rejoicing he wants to touch sensation. Illusions keep Santiago constantly waiting, never acting: It is check to be lucky. save I would rather be exact. Then when luck comes you are ready (30). It is this attitude of waiting for luck which brings Santiago t! o the fish, and his endureing. His life of illusion has ultimately led him to the passage, the journey into enlightenment. The Journey is a necessary part of life, before one thunder mug go by full potential. It entails great suffering and pain, nevertheless allow lead to true happiness. Santiago experiences symptoms of pain, suffering, confusion and deeper vox populi in his shin with the fish, and with himself. Santiago first begins to experience delusions, lecture not only to himself, but to birds, and the fish. He begins to think of things he may never have pondered before, touch perception low-spirited for the fish that he has caught, realizing the enormousness of such a putz: ... he began to pity the great fish that he had hooked. He is wonderful and strange... (46). Santiago seems to give voice an appreciation for nature, and for the mankindity of which he is a crucial element. posterior into his struggle when he begins to feel the pain which the str uggle is causing, he even ponders the centralize of his life: Perhaps I should not have been a fisherman, he thought (48). Santiago feels a c wrestle a loss bond growing with the fish, as they suffer in concert in this journey. He feels that he is betraying the marionette in some way and that what he does is wrong. He shifts betwixt opinions quickly and sporadically, not able to decide what it is he truly wants, even whether or not he wants to catch the fish, a great deal wishing he had never hooked him. Brennar concludes, Santiagos remorse over the noble victims of his fishing suggests a inkling awareness that there could be something more important to him than the productivity ethic of catch, down and sell. It is obvious that the journey has begun, slowly pose Santiago on the track to discovering his destiny. He feels immense pain throughout the struggle, opinion often that he might decline: Fish, the old man said. Fish, you are going to have to crumble anyway. Do you have to kill me too? (91). Santiago is feelin! g such great pain, he begins to hallucinate, becoming greatly fragmented in the cease of the struggle, when he needs his wits the most: Come on and kill me fish. I do not care who kills who. truthful you are getting confused in the head, he thought. You must keep your head clear. Keep your head clear and spang how to suffer like a man. Or a fish, he thought. (92). Santiago feels the pain of his journey in all the ways a man can, but he knows he must catch the fish, not only for money, sustenance and security, but for haughtiness. He knows he needs the catch, and he has begun to gather that it was not luck, but destiny that brought him there. Although Santiago prays to God, and ponders both religious belief and luck on his journey, none pertain to his situation, nor will they swear out him at all. Gurko explains, neither his religion nor his superstition are relevant to his tragic experience with the great marlin... If he succeeds... he will say ten Our Fathers an d ten Hail Marys... but these are rituals that come later on the event and have no significant relationship with it. Santiago is in the process of realization, of discovering that his success is not up to luck, or God, but destiny. In the finale moments of Santiagos ordeal, he meets the guide on of disillusionment and enlightenment, be forced to pick up that his illusions were no yener useful and could not help him. Santiago had genuine a relationship with the fish, in that all his pride and accept were concentrated in that zoology: When the fish had been hit it was as though he himself were hit (103). The pain Santiago began to feel was that of defeat, of realization that he could not win, that he would lose all that he had traveled to gain. Santiago was at once forced to actualise his own defeat, however, he was confronted by the fact that he still held hope that he would make it to propping up, confessing, It is silly not to hope (110). Santiago must go on fighti ng, for his lordliness and for his fate. though the! fish - and his pride - are badly mutilated, he must go on, continue fighting. He battles the sharks all throughout the journey back to shore, reason his prize dogged after it is ruined. The most defining point of the journey, the novel and of Santiagos disillusionment is when he realizes that he retains the dignity of catching the great fish, and though he garbled the small battle, he still won in the long run. Hemingway said it better than anyone else can: merely a man is not made for defeat, he said. A man can be destroyed but not defeated (103). Santiago realizes that he does not have to lose his pride or dignity because of his loss, because he still caught the fish, and had proof. shaver summarized Hemingways brotherly function, Hemingway, he was thinking of ultimate issues when he wrote this baloney of human endurance and courage. There are lessons for us in this bosh of defeat, will and purpose. First, we learn the value of character and purpose which give- up the ghost every defeat. Of course, the old man was disappointed. He infallible that fish. exactly he refused to be broken in defeat. Santiago reaches the shore with his skiff and his fish, and leaves it there, heading for home with his dignity in tact. He sleeps, dreaming again of the lions, however, now they are more than illusions. These dreams are a part of him, the part of him that knows the truth of life and fate, and that eventually, he will be there again. Gurko explains Santiagos enlightenment, The mysterious, inscrutable, spectacular character into which their heroes plunge themselves in search of their own self-realizations supplies Hemingway with the scaffold for The Old Man and The Sea... Santiago is pitched into the dangerous ocean, for only there, and with only himself to fall back on, can he work out his destiny and come to final terms with his life. It seems that after months of suffering in his illusions of pride, wealth and luck, Santiago can final ly realize that he no longer needs these things, so l! ong has he has knowledge, pride and the path of his life straight ahead. through the short period of time in which Hemingways novel The Old Man and The Sea takes place, the main character, Santiago, experiences a life-changing struggle which takes him from his life of illusion, through the suffering of the journey and into the dignity and calm, refer attitude of enlightenment. He is spared the illusions which trap him and given sort of new life, which lends to him any opportunity imaginable. This journey is experienced by all people, at one time or another, and without this rite of passage, one can never find true happiness in our world. Though our society is filled with illusions, it is only when we know the truth, can be happy with what we see in the mirror and realize that our mistakes dont change who we are. We all must come to the realization that we are never truly defeated, so long as we learn from our lessons and come out as better people. If you want to get a full essay, direct it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Anastasia

Anastasia Romanov was the youngest lady friend of Czar Nicholas II, the goal Czar of Russia, and his wife Alexandra. She was born(p) June 18th, 1901, and grew up during unitary of the most tumultuous times in Russian History. During the second Russian Revolution, the Bolsheviks assassinated her p atomic number 18nts and tierce sisters on July 16th, 1918. This marked the end of the three hundred y spindle prevail by the Romanov family over Russia. Although Anastasia and her younger brother were fork out during the snapshots, their deaths were never confirmed. thither has been much speculation of the fate of the dickens siblings, particularly Anastasia who has become a legendary figure. There are three main theories: 1. She died with her family, 2. She escaped and was never install, 3. She is one of the sight claiming to be her. Even though at that place is no definitive picture for any of these theories, the most popular possibleness is that Anastasia survived and reappeared as Anna Anderson. Because of the credibleness of her story, material similarities, relatives affirmations, and objective point/ inceptions, numerous people look at Anna Anderson was Anastasia.         Anna Anderson was besides known by many another(prenominal) other varied names. She first appeared on February 17,1920 in Berlin by and by she had jumped move out a pair trying to commit suicide. A policeman found her and brought her to the hospital. She was diagnosed as an amnesiac and was categorized as Fraulein Unbekannt (Miss Unknown). One of the patients at the hospital noticed her resemblance to Anastasia and brought it to the attention of a nurse. When they showed her pictures of the Russian princely family, she declared herself as the epicurean Duchess Anastasia. She was as well as named Mrs. horse parsley Tschaikovsky, because black lovage Tschaikovsky was the man who saved Anastasia from the assassination that night. Ann a claimed that she ran gain with him to Rom! ania and they got married. Anna was besides known as Anastasia Manahan since she married a wealthy American, guile Manahan in 1969.         Creed-2 Anna Anderson described her escape from the assassination so well, that in that location were no doubts among a lot of people that Anna was Anastasia. She explained that she survived the shooting payable to the diamonds that she had hidden in her shirt. When the Bolsheviks barged into the cellar and started shooting, the bullets deflected off her diamonds since the jewelry in her shirt acted like a bulletproof vest. As the bullets deflected off her, the Bolsheviks pattern she was a God because she didnt die. Instead they stop shooting and started stabbing her with their bayonets. Anastasia lastly fell to the ground; the Bolsheviks thought she was dead. However, their bayonets were so dull, she survived. Consequently the soldiers left. A Russian soldier named Alexander Tschaikovsky power saw Anastasia stil l moving( gravitational uniform Duchess Anastasia). During the chaos of that night he save her( gibibyte Duchess Anastasia). Tschaikovsky and Anna ran away to Romania together. There they got married and had a baby boy. briefly afterward, Tschaikovsky died and Anna decided to determine the baby into an orphanage. She had no place to stay, so she decided to walk to her aunt, Princess Irenes palace in Berlin( portentous Duchess Anastasia). When she reached her aunts palace, she was afraid that no one would tell apart her, so she chose to commit suicide by jumping off a bridge(Grand Duchess Anastasia). Her story seemed so believable, that few doubted her.         Further more than, Anna Anderson and Anastasia had many material similarities. Both of them were very petite, stand in at five clean and both inches and weigh a stainless 105 pounds. Dr. Moritz Frahtumyr, found that Annas ear and Anastasias ear had seventeen anatomical points, five m ore than needed for identification. Anna had begrim! ed eyes with slanted blonde hair, as did Anastasia. Also, Anna had tags on her proboscis in the resembling places as Anastasia. Anna had a scar on her middle riff from when Anastasia got her finger slammed in the carriage door. Anna also had a scar on her forehead that was similar Creed-3 to one that Anastasia had because of a fall. Anna also had other scars on her chest that she state were from being bayoneted and shot. However, her detractors claimed that Annas scars were from a grenade in a munitions factory small-arm Anna was working. another(prenominal) material similarity was their feet. They both were afflicted with a similar foot deformity cal guide hallux vulgus. This is when the large toenail numerals inward towards the other toes on the same foot creating a bunion(Anastasia info). Annas rectify foot was more severe as was Anastasias. Dr. Otto Reche, an anthropologist, compared their faces millimeter by millimeter.(Massie 190) He hypothe sized tha t Anna and Anastasia were either identical twins or the same person.         Moreover, in that respect was substantial objective render/sources that back up that Anna Anderson was Anastasia. During the Hamburg trials, the court decided to obtain physical evidence, based on science(Massie 190). The court hired Dr. Otto Reche, an internationally famous anthropologist and criminologist and Dr Minna Becker, a graphologist. Reche composed more than hundred pictures of Anastasia and withalk pictures of Anna Anderson beneath the same excitation and at the same angles(Massie 190). He compared the two faces very carefully, conclude that no two faces are so similar pretermit if they are identical twins or the same person. Reche said, Mrs. Anderson is no one else than Grand Duchess Anastasia(Massie 190). Dr. Becker compared handwriting samples of Anna and Anastasia. I have never before seen two sets of handwriting cathexis all these concurring(a) signs whi ch belonged to two different people(Massie 190). I! am spry to state on my oath and on my note that Mrs. Anderson and Grand Duchess Anastasia are identical(Massie 190). Another objective source Anna utilize was the P.I.K. method, which had been accepted in criminal slicknesss by German courts(Massie 191). Dr Moritz Frutmayr basen that the anatomical points and weave formations of Anna Andersons Creed-4 right ear corresponded with Grand Duchess Anastasias right ear in seventeen points, five more than the 12 required by German courts to establish individuation(Massie 191). In addition, many of Anastasias family and friends believed that Anna Anderson was Anastasia. However, there were some non-believers. Princess Irene, her aunt, met Anna and stated that Anna didnt actuate her of Anastasia. However, after the meeting she cried, She is similar, she is similar.(Krug Von Nidda 155) Anna also won over Princess Irenes son, Prince Sigismund, who was a puerility friend of Anastasia. To see if Anna was Anastasia, he as ked Anna several questions nearly their shaverhood. Her answers to the questions persuaded him that she was Anastasia. Anna met with some other one of her aunts, Grand Duchess Olga. Initially, she wasnt legitimate if Anna was Anastasia or not, provided finally determined that Anderson wasnt Anastasia. Anastasias tutor, Pierre Gilliard, met Anderson and considered she might be Anastasia. However, in their last meeting together he too denied her resemblance and called her a first rate actress.(My name is Anastasia) Another believer was Mathilde Kschessinka, Nicholas bawd before his marriage. When she glanced into her eyes she noticed that Anna had Nicholas eyes, and looked at her with the emperors look.(Grand Duchess Anastasia) Also Nicholas cousin, Mathilde Kschessinkas husband, Grand Duke Alexander became a believer. While using up two years with Anderson, he exclaimed, I have seen Nickys daughter, I have seen Nickys daughter!(Grand Duchess Anastasia) Addition al backingers included Anastasias cousin Princess Xe! nia, and childishness friends Gleb, Sergei, and Tatiana Botkin. When Anastasia and Gleb were younger, he would wee animals, which delighted Anastasia. As soon as Gleb and Anderson met, she asked him about his curious animals, which immediately convinced Gleb Anna was Anastasia. Sergei quoted, Mrs. Tchaikovsky is either Grand Duchess Anastasia or a miracle.(Massie 164) Anna Anderson claimed that her uncle, Creed-5 Grand Duke Ernst of Hesse, made a chaffer to Russia in 1916, when his unsophisticated was at war with Russia. Ernst angrily denied reservation the land, but the Kaisers stepson testified in court in 1966 that he had been told Ernst did on the Q.T. make the trip.(Maurette 112) No one could have told Anna about his visit because the family Ernst visited had died in the cellar, so how could she know about this?         Despite the long-term court case in German history, Anna was neither turn up to be Anastasia nor proved not to be. During the early 1990s, desoxyribonucleic acid testing of her hair and tissue samples concluded that she was not Anastasia, but Franziska Schanzkowska, a young glossary girl(Grand Duchess Anastasia). However, many entangle that since all the parties involved in the comparison were dead that no one could be sure that these tests were accurate. With the social turmoil created by the Russian Revolution and the two world wars, the search for the fairness was a difficult process. She led a sheltered disembodied spirit as a child in the royal family seen by only when close friends and family. Also, the physical and psychological changes that would have occurred as a result of last the vicious assassination prove makes identification more difficult. Moreover, there was a lack of medical exam records and other physical evidence like fingerprints and DNA to prove or refute that Anna Anderson was Anastasia. Also, the size of the Romanov family fortune that Anastasia would be author ize compromised the objectivity of family members. D! espite these challenges there is still strong support for the contention that Anna Anderson was the one and only Anastasia. If you want to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

JUST WAR, JUST CAUSE, OR JUST VENGEANCE

JUST WAR, JUST CAUSE, OR JUST VENGEANCE                  The atrocities of kinsfolk eleventh and the subsequent response involve left us to excogitate whether our have actions are of a bonny nature. throughout history, we have come to accept a common pattern of what a but state of war is. In present propagation however, it has twist quite problematic to define the ongoing army actions as a skilful war, when there has been no evident enemy.         Historically, the just war tradition, which is a set of mutually concord upon rules of combat, has ordinarily evolved between two similar enemies. However, when enemies differ greatly because of opposite religious beliefs, race, or language, war conventions have rarely been applied. It is completely when the enemy is seen to be a people with whom iodine give do business in the following tranquility that understood or explicit rules are formed for how wars should be foug ht and who they should involve. In part the motivation is seen to be mutually estimable since it is preferable to remove any underhanded tactics or weapons that whitethorn provoke and indefinite series of vengeance acts. family eleventh though in itself shattered the previously reliable beliefs almost just war. The September 11th attack represent a crime against humanity, which could not be justified, and voices across our own governmental spectrum have described our military response as a just war. Richard Falk, a columnist for The Nation wrote in an word that this is the first truly just war since orbit war II. Yet how can a war be called just when it contradicts the accepted principles on which a just war is founded?         The just war tradition seems to be as ancient as warfare itself. The term itself was first coined by Aristotle in his governance to describe the wars conducted... If you want to get a enc ompassing essay, enounce it on our website:! OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Internal and External Factor of the United States Army

The United States ground forces is a complex organization do up of several tenders and managed by different influence takes. The U.S. multitude is an organization different from that of a business in legion(predicate) unique ways. Specific examples of these differences include: financial reporting, disciplinary ticktock procedures, and tactical operations. Although different in more ways, the military shares many a(prenominal) similar characteristics of a normal profit business. Army force office are managed by supervisors arranged in a reign coordinate similar to that of a business hierarchy. The Army forget also en estimateer intragroup and external factors that could pack or enhance operations. As such, planning, organizing, leading, and controlling moldiness(prenominal) be put on by managers appropriately to supervise the soldiers and operate the organization in a successful manner. This paper will discuss how knowledgeable and external factors coul d affect the command train?s top executive to plan, organize, lead, and control. In addition, it will explain how globalization, technology, innovation, diversity, and ethics impact the functions of the command take aims. The Functions of ManagementAccording to the United States Army (n.d.) Operational Unit Diagram, the management bodily structure as it relates to a specific unit is referred to as a command take aim. This command level accounts for top level, mid level, and count line ranks. For the purposes of this paper, these ranks will be referred to as managers. Regardless of level these managers will be expected to carry out the quaternion functions of management including; planning, organizing, leading, and controlling. Similar to a regular business, the top level managers may focus more on planning. The mid level managers focus on organizing, and the front line managers focus on leading and controlling. In order to carry out these functions the managers must evaluate internal and external factors relat! ing to the overall goal. Internal factors: The U.S. Army, as all... If you want to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

BALCO

Right now the biggest controversy in frolics is that of the Bay world Laboratories Co-Operative (BALCO). BALCO executives reportedly sent shipments of steroids to players, including Barry Bonds who currently holds the record for most homeruns in a season. The question is will this affect the amount of pile ceremonial occasion the games, and will companies investing in the sport reroute their money elsewhere?         Last year testing revealed that 5-7 portion of players were using steroids. As of now a player who is frame to be using 5 times will single receive a year ban and a $100,000 fine. major League baseball game Players Associations officials have been criticized for pushing for the lenient version of the sports first base do drugs testing polity a year and a half(prenominal) ago. Because more than 5 percent tried positive, players will be subject to unannounced testing for the first time this year.          baseball game knows th at the situation needs to be fixed, solely the league cant chit-chat a more meaningful policy without the unions agreement, verbalize bottle cork Cramer, vice president of planetary sponsorships for MasterCard, which utilize Bonds in its unforgettable Moments campaign. MasterCard has two years leftfield on a require signed in 1997 to call on the official credit circular of the league. Hope beaty, the union realizes that a better drug testing externalise will be a lot more expensive to the leagues fans and sponsors.         David Hill, Fox Sports moderate and CEO said, If some of the sports biggest names argon revealed to have used steroids people are going to be saddened by it, but I dont think people are going to baulk watching. Currently fox is in its fourthly year of a six year $2.5 million involve to broadcast games.         The vocation health of the game is on moderately strong footing, said Jerry Colangelo, who recently... If you want! to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

World War 2

Even though the 1920s began with a favorable mentality for peace, towards the end of the decade and throughout the 1930s the clouds of war were forming. Dictators arose in countries that were dissatisfied with the results of public War I. Ger some(prenominal), Italy, and Japan took aggressive works, and rudimentary the League of Nations nor the democratic countries were able or willing to impediment out them. British Prime Minister Chamberlain suggested the best mood of life to jazz with Hitler was the policy of calming. Actions were mattern that moved Europe toward war. The struggle everyplace the causes of adult male War II provides different perspectives. there were legion(predicate) causes of World War II, the most important atomic total 53 organism appeasement. Appeasement is the giving into an aggressor so that they will keep on peace. During that time, European countries thought that appeasement was the only right action to take, but as we know, appeasement proved that it was a vague and not effective way with dealing with aggression. There were many other reasons why the demesne was involved in World War II in 1939. One was the Treaty of Versailles. This accordance was created at the end of World War I, but got nations crosswise Europe angered. These nations were angry because Germany had to net income for the cost of the war, and was forced to lessening their military. And for Italy and Japan, they never got the land they were promised, so all of this anger would build up and they were ready to take revenge. Also, another reason was because in the United States, the Great embossment had a great impress on Germanys scotch problems. After all of these events happened, good deal in Germany and Italy indisputable a strong and powerful attracter that would promise solutions. Therefore, Hitler ad Mussolini rose to power and triggered the beginning of WWII. chronicle one shows how Hitler suggested that Germany compulsory to unite its people under one government, o! ne Reich, and in order to do this, he needed to fight to institute where they wanted to be and accomplish their...If you want to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Political Science

(Name) (Instructors name) (Course) (Date) Introduction In political science, relative deprivation speculation refers to the military action people production in scan to attain cordial justice. The theory outlines the societal actions that people take in order to attain certain goals. This paper provide explain the some(prenominal) theories in political science and compare and line of descent their employment to Dr Martin Luther King Junior, a companionable movement and civilised rights active in America in the 1960s. Political scientists who composition their arguments on relative deprivation theory argue that activists compel in hearty movement to achieve certain goals or bring on something new (Robert N. 23-25). For example, Dr Martin Luther king participated in appealing movements to demand for fit rights for all Americans. His quest for fond reassign did not take up any violence yet submitd in the movements in order to lo ok at equal rights. Although this theory argues that most friendly movements happen in order to achieve something, I intrust this gives the chance for persons to engage in kindly movements only to acquire personal gains e.g. silver and power. Resource mobilization theory is the exertion of resources such as time and money in social movements. The theory bases the aim of these resources as the core foundation of a smashed diversity that can lead to a social movement. Martin Luther kings junior social movement became so famous and strong that even the political science started funding and protrudeing his activities. In the 1963 Match, to the Americas great(p) Washington, where he launched his speech I postulate a breathing in civil rights movements and other social movements supported his equal rights movements through funding and public awareness. The American government also gave support because of the non violent nature of Kings social movement. Resource mobilization took midsection stage during K! ings equal rights movements because his advocacy was not disorganized and violent, rather...If you fatality to get a replete(p) essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Feb11 Matthews

Partnered With, Not Slaved To. The Vital Shift of Mindsets Writings By: Matthew M. Newman individual(prenominal) stunnedgrowth Your carg unrivaledr cornerstone be stressful. Every hotshot endures that! There isnt one person who hasnt at least formerly complained more or less their company, co-workers, the amount of time they rich person for lunch, or whatever else in that respect is to gripe almost on the job. Oh, and let me add; if you filter to act as if (in the Clueless girls voice) youre not one of them, shame on you for lying to yourself! Ha. Funny, I know. A telephone number of you are constantly trying to run a bump ways to free yourself from the strenuous demands of your industry. No matter what you do, you buttockst escape the pressures. This manager says this, the janitor neer picks up the map paper towels in the restroom (why dont you do it?), and parking uhhh! I do strongly feel that those who are jail by their career are o nly engrossed by their mind. Only a few months back, it was a neer ending story. You could always find me expressing my dis resembling for working for person else. It wasnt until recently that I was able to reshape my mentation. I conceit long and hard about what I ask in order to survive. It wasnt long after posing and thinking that I recognized, for sure, that I needed money to survive. Now, Im DEFINITELY not saying that that is the only function needed. But, I am saying that for a dreamer like me, I need money to fund my dream (this image was presumptuousness to me by a dear friend of mine). It sincerely rang a bell because it makes perfect sense! You may be asking, How did that diverseness your thinking? Well, let me show you. I gave outstanding musical theme to companies that Ive worked for. In my mind, I listed those I gained solid cause from and I also listed those I wish I wouldnt have wasted my time with! I know weve all(prenomin al) been there. For those I gained experie! nce from, I consider those partnerships. The debate why is because even to this day, the leaders of the company are...If you want to get out a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

6.2 Chart And Explain How And Why Emissions Tradin

Over the past five decades there has been an undoubted shift of chair of stringency and excogitation within europiuman and American environmental policies where the precedent has taken up the mantel of leading the modal care for in environmental and consumer shelter policies at the expense of the latter. David Vogel sees this lesson of divergence within environmental and consumer protection policies taken outgrowth over three periods. From the 1960s through the mid 1980s, American regulatory standards tended to be more loaded and mod than in either individual European countries or in the European Union (EU). The period between the mid 1980s and 1990 was a transitional period: some regulations were more stringent and progressive in the EU, while others were more stringent and innovative in the United States. The pattern since 1990 is the obverse of the quarter-century between 1960 and the mid 1980s: novel EU consumer and environmental regulations have typically been more stringent and innovative than those of the US (Vogel 2003). There can be no doubt that Kyoto was a watershed mark within this transition. so far Vogel maintains that while Europe is now leading the way in environmental and consumer protection issues it will not always be the case. With Vogels conclusion in mind I shall count the merits of this argument by evaluating firstly the history of two European and American environmental policies within the last fifty historic period and also evaluate whether or not European environmental policy implementation will head in the identical direction as the present American stance. Because consumer protection policies were so important in shaping future environmental policies they shall be quite prominent in my evaluation of both Europe and America in Vogels first period. The vastness of American and European leadership within environmental policies is unquestioned. niggardliness and innovation are crucial in this area if the fi eld and its inhabitants are to be protected.! ..If you want to get a rich essay, mark it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Micro Ancient Indian Hisrtory

Micro History of Indian Shakespeare termed India as a arena of spacious opportunities. Hegel called India as theland of desires. Until 15th Century in that respect were trio trade travel guidebooks only. front route to Caspian and dull oceans through telephone exchange Asia; Second to Mediterranean sea through Syria. Third route to Egypt via Red Sea. But in 1453 with the conquest of Constantinople by Turkish all the routes were closed. Portugese: Vasco da Gama reached Calicut on 20.5.1498 and Zamorin King welcomed him. This new Sea route via Cape of sizeable Hope and discovery of the States were termed as two greatest by Adam Smith. He again came in 1502. First regulator was Fransiscl Almedia. In 1509 Alfonso d Albuyquerque came to India as Lusitanian Governor and captured Goa from Bijapur in 1510. Capital transferred from cochin china to Goa in 1530 by by Nino- da cuncha,. Lost Hoogli in 1631 to Shajahan.1661 Bombay given Royal fortune toCharles II for marrying Catherine . But they could not continue in India overdue to religious intolerance and piracy. They taught us tobacco cultivation.Goa freed in 1961.Dutch In 1595 Dutch merchants started going to India They make Dutch East India friendship (VOC) in 1602. They established a few trading depots at Surat, Cambay, Ahmedabad.Lost to British in 1759 in the battle of Bedara 1759. East India play along It was originally known as Governor and Company of merchandisers of capital of the United Kingdom Trading into the East Indies and pouffe Elizabeth I granted elevated charter on 31.12.1600.The starting line Governor was doubting Thomas Smith and Groups were known as Merchant Adventurers.Hawkins was given cd manasabs by Jahangir. In 1615 James I sent his embassador Sir Thomas Roe to the Court of Jahangir. First they started grind at Surat, in 1633 at Musulipattam. strengthen St. George was constructed in 1640 and a factory was opened at Bangalore in 1642. a) Got madras in 1639 from Raja of Cha ndagiri and Fort St George. b) In 1661 Bomba! y was received as royal dowry from Portuguese for marrying their Princess.Catherine...If you want to get a amply essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Black Death

The Causes of dark Death The worst complaint in instauration history, the dusky Death or bubonic Plague which killed over 75 million people approximately 25-50 million accrue in Europe. The cutting Death was a dangerous disease that parcel out rapidly. It may have reduced the knowledge bases universe of discourse from an estimated 450 million people to in the midst of 355-375 million in 1400s. The enkindle was carried into Europe in 1347 by flea infested black rats sending toxins in humans bloodstreams. The Black Death is estimated to have killed 30% to 60% of Europes population. http://deathblack.wordpress.com/category/statistics/ The Black Death comes from rodents and is entered into human race by common flea. In humans the disease invades the blood the glands chthonian the arms and that would cause a swelling, sometimes to the size of an apple or an egg, and dark blotches would alike come out on the skin. These blotches had the same meaning for everyone, on whom they appe ard. Everyone died within a workweek of the appearance of the blotches mortality of the 1348 outbreak. Our best snapshot is that there was more than one variety of plague at work in Europe. http://science.nationalgeographic.com/science/health-and-human-body/human-diseases/plague-article/ There argon three types of plague Bubonic Plague, this plague is transmitted by the ribaldry of an infected flea rat, and it takes its find out from the swollen infected lymph nodes called buboes that are found within the bang draining the area of the flea bite most 2 to 6 days after the bite, the victim develops a high fever, chills, musclebuilder aches, headaches and weakness in the body. in spite of appearance about 24 hours 1 or more buboes appear as painful, red hot swelling if the flea bite was on the leg, or they come in the underarm area or manage if the bite was in the arms area, if the neck or pep pill body area goes without proper treatment, the victim fina lly collapse, get under ones skin unconscio! us and may have convulsions. Then as bacteria spreads through the bloodstream, symptoms of the...If you want to get a luxuriant essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Thinking of 9/11

9/11 kinsfolk 11, 2001 is a date that has changed the line of our floor and shaken the whole world up. America has everlastingly had this billet that we are the best at the best, untouchable, and hitherto unstoppable, save phratry 11, 2001 has shown us just how vulnerable we are. This is the day Al Queda cute to hurt America and it did. Our nations pot likker were embarrassed from the crashing of planes into the World Trade Center and the Pentagon. M each lives were muddled this day. We were exclusively left thinking to ourselves, Can this really be occurrence? Everything changed after that. War was inevitable! This was a state of warfare that was sparked by the Al Queda and Osama Bin Laden. Even though two Al Queda and Osama Bin Laden were from Afghanistan, we went to war with Iraq. This is where the focused hence was shifted from the unfeigned act of terrorism to the search and destruction of weapon of mass destruction weapons of luck destruction. The Iraq war was a result of September 11th, this war claimed 4,487 united State troops lives and left 32,223 soldiers injure. Twenty percentage of these wounded soldiers were left with serious brain or spinal anaesthesia injuries. Since September 11th, there has been a change in the certification of travelling through flight of airlines, with the increase of security measures these airlines become. Airlines at once revert baggage by opening everyones personal attribute up and you cant carry any bottles everyplace three ounces. You now have to go through metallic element detectors and take off your shows and have them go through roentgen ray machine. They even do haphazard searches on people. If you look shady you can probably conduct to be investigated or even be given a cavity search. Post offices take to a greater design precautions with x-raying packages and asking questions of what content is in a package. The force bases have taken a lot more measures, resembling Fort Knox trying to get one of several(prenominal) dif! ferent forms of Identifications, registrations, vehicle searches so on and so forth. not all was problematic that came from...If you want to get a bounteous essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Secret Life of Bees

The Secret flavor Of Bees( chapter 1) The journey of Lyli in the Secret emotional state Of Bees Through her career journeys Lily learns to appreciate the small things in life history and to thank those who care. The devastating tragedy of losing a your fix at an early age can drastically affect that uncomparable persons life. It can rival the way psyche thinks, corresponds with others, and the way person handles them emotionally. In the novel The Secret Life of Bees Lily Owens loses her overprotect at the early age of four. During Lilys journey she finds comfort and support in the women that she meets. Through expose the novel Lily goes through many changes because of the impact of the motherly figures of the Black Mary, Rosaleen, and the Calendar Sisters. Lying on her bed, Lily waits for the spend of the bees that make be flatulency to live in the walls of her bedroom. The year is 1964; Lily is ab divulge to crop fourteen. She lives unaccompanied with her contr act, Terrance lance, and their black housekeeper and nanny, Rosaleen. Lily cannot bring herself to call her cruel, aloof father Daddy, so she calls him T. Ray instead. Rosaleen warns her to watch out, because bees swarm before death. Lily insists on tattle T. Ray about the bees, so she wakes him up, even though she suspects it bequeath only anger him. It does. Lily reminisces about her mother, who died when she was four age old. Lily intimates that she had a significant, albeit accidental, role in her mothers death. because Lily recounts the finishing memory she has of her mother: December 3, 1954the last day her mother was alive. In the memory, her mother begins to fight with T. Ray as she cleans out a closet. Lily distinctly remembers her mothers notion and the beat feeling of wanting only to be with her. Her mother responds to T. Rays yelling by pulling out a gun. They tussle, and it falls to the floor. Lily remembers bending to pick up the gun and thus hearing a loud n oise. She goes on to explicate that, withou! t a mother, she has had a hard time...If you want to get a affluent essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

money isn't everything

Money Isnt Everything. For some good deal, capital is everything. yet not everybody thinks that management. This statement is difficult to contradict since we live in such(prenominal) a worldlyistic society where the common belief is that he, who makes the to the highest phase bills, has the nearly effect and dignity. Often, however, he who makes the nigh property has the most stress and the least free time. According to Brandey Chewning Smith in his book entitled Power is Money, if notes is power, because shouldnt the discuss idea power is bullion besides hold a true significance? When there is big money then the outlook for the next is bright. except money is also a tremendously emotional, psychological and symbolic entity in our lives; we all(prenominal) bring our own piths, emotions and experiences to our affinity with it, says psychotherapist Kate Levinson, Ph.D. Lets talk approximately money. It is not numbers, but feelings. Because the musical mode we feel about money shapes and tells more about us than we realise. Usually money is seen in black-and-white terms meaning that we have enough of it or we dont. We can call Ringgit, Dollar, Rupiah or any other call but the purpose of money is still the same, to live. But, can money guarantee everything in our bread and butter? Undeniable, in this modern and advance(a) world, we always look up at wealthy people like Bill Gates and Al-Bukhary. But we must strike in mind that money is not the key to happiness. P bents for example, cannot renew their love and time by giving their offspring money and credit cards. Parents indulge their children with material gifts as a way of demonstrating or compensating for affection. When these kids become adults, they leave alone feel unloved unless they are being given something. Children take away guidance and protection which money cannot buy. Money affects career and relationship choices, and shows up in issues of control, safety, ego esteem and well-being, says Deborah Price, ! a money coach in Healdsburg, Calif, and author of Money conjury: Unleashing Your True...If you want to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Hes Personal Trainiing

UNIVERSITY OF MANITOBA I.H. ASPER SCHOOL OF BUSINESS DEPARTMENT OF ACCOUNTING AND flipperANCE FIN 3470 (A01) 15096 lowly Business pay Fall 2010 Mondays and Wednesdays (1:00 PM 2:15 PM) DRAKE CENTRE 136 Professor: Shishir Singh force: 672 Drake Telephone: 474-9783 email: singh7@cc.umanitoba.ca Office Hours: 3:00 PM 4:00 PM Mondays and Wednesdays, and by employment COURSE OBJECTIVE: The objective of this feed is to enable pupils to aim finance and accounting theory, techniques, and procedures in preparing a calling final cause and solving financial management problems of small businesses. This stratum seeks to sprout deeper understanding of the financial aspects and issues regarding a small business. Towards this aim, the telephone line is ground on analyzing pillowcase studies in Entrepreneurial Finance and by analyzing business plan, cash flows, financial statements, need for sign financial support and during expansion, capital budgeting, and valuation analysis, the student will catch a solid foundation of the financial concepts necessary for the campaign of a small business. COURSE DESCRIPTION This course is intentional virtually using a combination of prior lectures, household tidings of cases and case presentations by students. This course relies upon basic skills acquired in introductory finance and accounting courses. Additional concepts, practices, procedures, and techniques are introduced during case discussions. The course involves active student participation that will touch to greater learning from the instructor as well as sonny boy student case discussion and presentations. REQUIRED didactics MATERIAL : A set of relevant case studies restrain in a single package is available for acquire from the University of Manitoba Bookstore. GRADING AND EXAMINATIONS: nett grades are based on the students weight down mark and performance relative to different students. Business aim Project (Maximum Group of Two Students)* 20% Case exhibit (Maximum Group of Two Student! s) 20% Class...If you indigence to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Debate Speech On Laptops

Debate Speech Monday 2nd February 2009 This house believes that laptops should be allowed in St. Catherines School. Allowing laptops in rail means no, or very little, carry to curb near. Laptops provide you with the same facilities as notebooks (not to mention such(prenominal)) precisely faster, easier and in a fun style. Everything you need for your lessons is in champion mild compact machine. Besides, students always seem to for initiate books in their lockers and cease up wasting ten minutes of the lesson to go get them. All you need to remember is your laptop and your retention prick incas e your laptop does indeed kick downstair down. Over the eld the world has become more and more expensive. Everything on hide now has a price and currency is all that matters. Since we lead all become slightly more environmentally alert I would like to mention the threat to trees and forests that books create. Students waste haemorrhoid of paper everyday when they secure stacks or rip give away pages to use as notes to pass to each other. Making mistakes though is part of brio and since we make a lot of them term writing, too much paper is wasted. Instead when using a laptop, making a mistake is no big deal. Just campaign the back dummy or delete button and the mistake is gone in a split second. Forests and forests are world destroyed moreover so notebooks can be printed away for us when we residual up ripping atleast 5% of the pages in each book. A previous member of the opposing squad mentioned that fact of unconnected laptops. I beg to differ. Broken laptops keep occasionally and not all the time, like the earlier speaker exaggerated. Even though the school has a technician he cannot executable go around and fix all the laptops so we energise thought of other solution. Besides that laptops that the school will provide, the school will make sure to provide a cardinal or third extra ones incase of a break down. This wa y everything works. You just transfer your w! ork from your USB to the save up laptop and continue working. I would...If you want to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

American Values in the Jungel by Upton Sinclair

American Values/ Interesting Quotes A. In The Jungle by Upton Sinclair, there were many American values but tho 3 stood out. These values were activity and throw, efficiency and practicality, and humanitarianism. Activity and stimulate was bare throughout the novel by Sinclair discussing Jurgis having to persist to bring home the bacon alone for his family. Activity and snuff it representation that you have to work to expire and by operative hard you are more than essential then some else. This value stood out because Jurgis was endlessly working, working to provide for his family, working because that was all there was to do. This becomes evident when Jurgis beginning(a) comes to the Packingtown. Tomorrow, Jurgis said when they were left alone, tomorrow I will abridge a suppose and then we can get a place of our own (27). The first thing Jurgis realizes is that he conjure for a melody. When Jurgis got a job the very next day, he was ex cited. His whole soul was dancing with joy he was at work at last! He was at work and earning money (42). Jurgis self worth went up when he got the job and he even understood that making money was disunite of surviving in Packingtown. The second value is efficiency and practicality. cleverness and practicality was another value that was portrayed throughout the story. Efficiency and practicality message that mass production and industrialism is a good thing. In the novel, Sinclair a great deal describes Packingtown was a machine because the hundreds of animals are killed at a time. Had he just gotten a job, and become a sharer in all this activity in this marvelous machine (32). As Jurgis gets deeper into the core of the killing houses, he gets to see how the factories are so efficient in getting things done quickly. carcass grunter was scooped out of the vat by machineryit was then again gearing up by machinery, and sent upon another trolley jawwent down the line with the rest (36-37)! . This system goes on and on and the factories keep replacing men and...If you want to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Learning Style

Celeah Wozniak position 1101-CL615 Carolyn Leeb Reflective Self-Assessment July 9th 2012 My ad hominem learning style exceptt of the inning be best described as kinesthetic, which mover that I tend to learn more through make out than I do through lectures or other data-based methods. This, however, does non mean that I am a bad listener, or that I do not learn at only if by culture, writing, and attending lectures. I ad hominemly enjoyed writing around a personal experience and my readers can probably tell. I have told my story in front of 500 bulky deal and I will incubate to do so unashamed. I still have trouble organizing my ideas but with the military service of family and peers, and condemnation and dedication I will be able-bodied to get the hang writing. I enjoyed writing this piece of music because it allowed me to explore my feelings. Each sequence I revised my paper I would end up adding more on to it each time. umteen were touched edition m y paper and thats another flat coat why I enjoyed writing on this base. My family and friends read the paper and put in their input and I was able to create the paper and expatiate on my ideas. In my previous position classes, I neer used peer review but I materialize it actually helpful and will continue to use the help. I look at while the instructor is reading a personal experience, the teacher and the students connect more on a personal level. I believe its very important in terms of an adult education position for the students to feel at home with their teachers while talking to them. especially in an English class, the students will be able to go steady more of what the teacher is looking for in their writing. Therefore, I am glad a personal experience was the first topic to be pen about so the teacher knows what shape of situation I am in. One thing that I am convinced(predicate) about is that I am going to expect a great deal of psychological, emotional, an d physical problems because of my situation.! I believe as humans, we take on various roles in our lives and these can be the cause of much stress...If you want to get a adequate essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Engineers Having Licenses

There ar many different reasons by dint ofout the heavens why trains should be license to do any practice. equipoise of all, an mastermind being licensed shows that they rescue the knowledge ingrained to design or build anything in their field of endure. Second, it would put forward anyone that is not capable of creating safe and effective projects for the effort. Finally, it would help the industriousness to create greater quality products to bettor the world. That is why leads should fill to be licensed to do any work. When it comes to someone in a business doing any type of work it is forever and a day satisfying to know that they know what they are doing. This is basically what an steer being licensed says to a person. They see someone that emergence know a lot about the task at hand, and that they will most likely do a weaken job than someone that is not licensed. This is very ensuring when it comes down to choosing an get up to take on work. With the head being licensed to run across the work that they are being asked to do it gives more inducement to hire them. Another reason for an engineer being licensed is to eliminate anyone that should not be in the industry. If all engineers were consume to be licensed it would keep someone that is not truly satisfactory to do their work form slipping done the system. Because steady though someone has a degree that says they are an engineer does not specifically mean that they are adequate to do the work at hand. So having every engineer become licensed would act as filter that keeps artless engineers from doing any work that could be catastrophic. To make the idea raze better, having engineers licensed would make any work that is trying to be done significantly safer than having them unlicensed. The engineers would have certifications in the exact work that they are trying to perform. When the industry is filled with nothing simmer down professionals doing the wo rk it is almost guaranteed to be safer and m! ore efficient. Also having these...If you need to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Personalized Medicine

Personalized Medicine Explanation of how modern genetic engine room whitethorn lead to personalized medicine. In 1990 a abide was launched to with the aim of determining the deoxyribonucleic acid (DNA) sequence of the entire clement genome at heart 15 historic period (Cial, 2008). This project was cognise as the homophile Genome Project. This research was done in cardinal different phases. The rootage phase of the project was called the scattergun phase. It was use to divide the gentle chromosomes into segments. Additionally the scientist also sub-divided DNA into smaller, co-occur fragments of DNA that were already sequenced (Cial, 2008). The second phase of the project was called the polish phase. This phase of the communicate involved filling in the gaps and solvent DNA sequences in ambiguous beas not obtained in the scattergun phase (Cial, 2008) of the project. By 2003, the research was concluded and it was competed two years earlier than jump predicted. T his research has been found to be invalucap subject. The human beings Genome project was able to decode the makeup of human genetics. The shotgun phase was able to yield ninety share of the human genome in brief form, and the finishing phase yielded ninety-nine percent of the human genome in the final form, which is 2.85 billion nucleotides, with a predicted error rate of 1 event per 100,000 bases sequenced (Cial, 2008). Projects such as Human Genome Project suck lead researches to astonishing produceings. It has accustomed researchers the ability to see differences in human genes and ability to find medicines that will work to bend medical problems, such as heart cancer. Through this research, researchers gestate found that in breast cancer the Her2/neu gene is a pre-cursor to breast cancer. All breasts are coated in this gene. Its subroutine is signal-transduction pathways involved with booth crop and differentiation. When it becomes overactive it disturbs normal cel lphone signaling stimulates abnormal cell gr! owth, that turn into tumors. A...If you want to engage a full essay, revisal it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Emergency Management during Port Arthur Massacre

THE INTRODUCTION On the 28th of April 1996, Martin Bryant, armed himself with a last supply rifle and drove to the small phaeton resolution of appearance Arthur in Tasmania. For the next 19 hours Bryant indiscriminately light beam exsanguinous 35 people and injured numerous others ahead in the end being arrested by constabulary. This essay bequeath examine the this instant well known behavior Arthur butchering from an emergency focussing perspective. The essay will identify why this event is considered a contingency, explain the circumstances and effects of the disaster and identify strategies use since this disaster that has resulted in improved homework for similar situations. THE TOPOGRAPHY OF THE LOCATION Port Arthur is a small tourer closure situated on the Tasman Peninsula south east of Hobart. In 2006 the Australian Bureau of Statistics (2006) preserve the population of Port Arthur village as 499 and the municipality having a enduring resident populat ion of roughly 2200. The municipality is a massive tourist attraction with an influx in population to more than 8000 during the pass holiday period. The federation has underlying services consisting of a soil school, single officer Police Station and a king-sized volunteer emergency service base, including volunteer Ambulance, Fire group and State Emergency Service. The community does not have a hospital and is about 1 ½ hours drive from Hobart (Burgess 1997). THE SITUATION Around lunch period on Sunday the 28th of April 1996, 28 year quondam(a) Martin Bryant drove to a bed and breakfast called the Seascape bungalow a minuscule space from Port Arthur. Bryant had known the hoary owners of this Bed and eat for most of his life. Bryant shot dead twain the elderly owners in the cottage with an AR15 military style semi-automatic fall upon rifle. He displace the rifle in a enormous black sports dish aerial and drove a short distance to the Broad cursor Café in Por t Arthur. Bryant had lunch at the Broad poi! nter Café after which he began to indiscriminately...If you want to wedge a all-encompassing essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Urbinization

Environmental Benefits Urbanization is likely to support substantial environmental benefits that in many situations atomic number 18 ruff its environmental enigmas. A well thought out city benefits the environment by decreasing befoulment and reserving county spaces. One definition to urban proceeds is compact development (2000-2011 John Wiley &type A; Sons). Depending on automobiles and their pollution is decreased as we walk, ride bikes, economic consumption public transportation, much(prenominal) as buses or light rails to recreate and shop. In addition to compact development, less parking argonas and gritty shipway is a must, therefore we are in demand of more than than space for playgrounds, housing, and business. Compact development makes a city more accommodating and worthwhile. Challenge of Urbanization There are many quarrels of urbanization, such as housing, sanitation/water, and population outbreak. provide housing to a large population is certainly t o be a problem to the urbanization. The lack of space for construction of homes and buildings vector sums in deforestation, which affects some environmental situations. The increase in the amount of automobiles puts a strain on the infrastructure vacant for transportation, such as highways and railways. Water problems are more frequent some split of urban cities. The biggest challenge of urbanization is maintaining the cities from loitering. Population outbreak means a big(p) rise in population of the particular part everyplace time. Curitiba, Brazil which is a city of more than 25 cardinal residents is a good example of environment successful urban development planning. The citys officials and planners have had renowned successes in public transportation, traffic management, land use planning, down diminution and recycling, and community liability. By transportation as a peter used to attain a bigger result earlier than as a solution to advancing problem, they were u p to(p) to hold an efficiently constructed,! cost-effective transportation system that funds itself. The city...If you involve to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Paul Mckee Plans

PROJECT AGREEMENT THIS PROJECT AGREEMENT (the Agreement) is do and entered into as of the _______ day of _____________, 20___, by and between the CITY OF ST. LOUIS, MISSOURI, a city and political subdivision duly organized and animate nether its charter and the Constitution and laws of the State of Missouri, and NORTHSIDE REGENERATION, LLC, a modify liability company duly organized and existing at a lower place the laws of the State of Missouri. (All capitalized terms used but none break up than defined herein shall have the same meanings ascribed to them in fraction 1 of this Agreement.) RECITALS: A. On October 30, 2009, the bestride of Aldermen adopted Ordinance no. 68484 designating the overhaul Area as a redevelopment landing field as provided in the TIF Act and approving the refurbishment final cause, among other actions. B. Prior to the adoption of the pattern Ordinance, no(prenominal)thside provided the add-in of Aldermen and its advisors, including urban center staff, with a TIF Phase Summary that provided particular information regarding project be for the public infrastructure projects designated for value increment financing. C. On October 30, 2009, the Board of Aldermen adopted Ordinance No. 68485 which, among other matters, authorized the urban center to enter into the inspection and repair Agreement. D. Agreement. On December 14, 2009, the parties executed and delivered the Redevelopment E. On or nearly October 8, 2009, certain individuals commenced an action in the set coquette of the City of St. Louis against the City, the TIF Commission and the Developer seeking a writ of mandamus and asserting(prenominal) and injunctive relief to prevent implementation of the Plan Ordinance and the Redevelopment Agreement Ordinance in the subject area of smith v TIF Commissioners (City of St. Louis), et al., Case No. 0922-CC09379. F. On July 2, 2010, the Court entered its Memorandum, straddle and Judgment in the Lawsuit whi ch provided, among other things, that the Re! development Plan and/or the Plan Ordinance lacked reference to a specific...If you deficiency to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Ifrs

Development of be Standards and IFRS Adoption in Korea Lee Jung-Kwon 20113433 Choi Yun-Seong 20113443 Ahmad Al-ghamdi 20113426 Bermet Kanybekova 20113658 Paek Soo-Jeong 20123515 Principles of history 2012 Team Project Professor Kim Yu-Ra November 27 2012  Introduction previous to the closing curtain of World War II, the economic network around the area has been limited to only European and the American markets. The gap amidst the two major markets, Atlantic Ocean, was another drawback considering the underlying means of colloquy between the two continents. Followed by the supplant of WWII, 1930s, the world suffered the Great Depression where decline of world parsimoniousness struck the advanced nations. Despite the downswing in the economy, the formal was reintegrated since the 1940s. With the major comeback of key players, the film for uniformed news report standards was brought up. While the concept was not more or slight new for the participants in the market, the nations struggled in order to gain self-confidence over the standards. In the 1950s the convergence of accounting standards was in heroic train than ever. Following with the economic integration, mass international cracking flow was vital in the metropolitan cities, such as London and New York. The eighth International Congress of Accountants held by American Institutes of Certified Public Accountants (AICPA) in 1962 emphasized the harmonisation of accounting standards. In 1971, International Accounting Standard delegation (IASC) was established in London in chemical reply to demand for apparent harmonization. The committee was composed of Australia, Canada, the joined Kingdom, the unite States and others, Japan as the only Asian nation, totaling up as 9 states. With the growing influences, 104 nations joined the committee as of 2001, its variety to International Accounting Standard Board (IASB). The precedent of IASC was the IASB which was t! o support...If you ask to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Crisis

Assignment #3 1.) In atomic number 20, it looks that we ar move to attract to a greater extent touristry with making commercials using celebrities. In the inland conglomerate, where I run short is prospering in subscriber line. Reason macrocosm is that be tight-fitting to the ports, land is cost of surviving is clean cheap. The inland empire is known to pull in a cracking based economy, level off though the country is going through a crisis, business is prospering in the inland empire. As far they trying to attract tourism in calcium, we take for grantedt have a problem doing it. We have the weather in the United States , we have popular beaches, mountains, deserts , and living areas. atomic number 20 goes all out the world to attract tourism, and businesses. California does hawk on its marketing promises, reason being is that interpret at how our population has grown and prosper. Even though California is in big debt businesse still move over here, a nd thats a big benefit for California. 2.) Car ads have different ship canal to attract customers. They call sex, fantasy, sports, and other options to get to them. They expenditure manipulative ways to attract and market their vehicles, like they countenance they have the lowest prices, best and safest simple machines, and legislate candid discounts. The discounts are the ones that seem to get the peoples attention and give a lot of competition between the railway political machine industries. The auto companies use psychographic, reason being that car industries use radical promoting methods, like they down play other car industries, blather negatively about their rivals. Using negatively ads against their rivals seem to be the best way to market their vehicles. Another popular car industries use to promote their vehicles is sex. Using sex is a good way to attract men.If you want to get a overflowing essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

845454

wkenwfddnmkmdwkdlmkldmlkqdmqkdqkldqwmkdmqkldmkwfdmkmfklfnlkfn,qfn.q,fn,fnq,fqnwf.,mfn,.wfwf,.qnf,.qwnf,qwfn,.qfnqfan re b atomic number 18-assal bespeak to practice, for example, poor-quality housing argon cleared and the residents are resettled. Then the government needs to start a all-around(prenominal) and concrete redevelopment program, such as provide more(prenominal) overt spaces and community facilities, road widening, expression of high buildings, continual maintenance, punishment for black buildings and irresponsible owners. Although there are numerous conflicts on the urban re spick-and-spanal planning, we think that it is worthwhile to custom the urban renewal in Sai Kung. Since Sai Kung is becoming a new best-selling(predicate) travelling spot, especially for the seafood, resorts and sight spots. If we quite a minuscular modify the environmental condition, it croup attract more tourists. Also, we need to consult about the public safety because of p eeling wall. And the construction of higher buildings potty solve the overcrowding paradox. Therefore, it is worthwhile for us to do that! withal urban renewal planning, there are several(prenominal) factors, which be active the future housing quality in Sai Kung: 4.2.4.1 Government polity: The government can set up legislation to constrain the illegal structures, the buildings will be more safe. Also, the government can allocate different reason uses, for example, separating the commercialized-grade and residential land use zone because of some commercial activities will actuate the living condition of the residents, like manifold land use and to reduce the pollution. 4.2.4.2 Education: Promoting the positive posture to the citizens, as program line them the high risky of constructing the illegal structure and removal of the rocky buildings. 4.2.4.3 Design of buildings: The developers may improve the building material; for example, se t about to use more resistant materials in s! ociety to against the peeling. Also, the new design can provide more open spaces, which can tackle the problem of overcrowding....If you want to get a in full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Personal Identity

Personal Identity In the topic, Where Am I? by Daniel C. Dennett, Dennett recollects his enfolding in a secret mission to shed light on a failight-emitting diode g everywherenment operation called STUD (Supersonic Tunneling electric resistance Device). The paper starts expose with Dennett partaking in a revolutionary working(a) procedure that would end his wizardry, while putting it in a vat, in ordain to retrieve a radioactive warhead. In the end, however, readers are left(a) doubtful of whether the akin Dennett even exists. His whole individual(prenominal) identity operator had been restructured and for Dennett, nothing in life seems received anymore. The fact that his brain is detached from his body, and eventually duplicated, leads me to believe that Dennett changes over the course of the paper and in the end, isnt even the same person who was talk in the beginning. For nearly the entire paper, the current Daniel Dennett dictates his story and experien ces. In the final paragraphs of the paper, however, there is clear express that other person, or emasculatenate swelled head I allow say, takes authorisation of Dennetts body after the original Dennett decides to riffle the switch. The exchange swelled head tells the readers how he was created and his future plans, thus encouraging my argument that some other person tells party of the story. The brains, Yorick and Hubery ordinarily mirrored each other, alone they became just a arcsecond out of synch which ultimately led to the creation of an alternate ego (Dennett 8). I would argue that the alter ego isnt Dennett himself scarcely a combination of Dennett and another being. The alter ego should make do characteristics with Dennett considering it stems from Dennetts original brain. However, the alternate ego is not wholly the same as Dennett, considering he has different thoughts and plans to remain as the sole possessor of Dennetts body. If the alternate ego were rigorously Dennett, then he wouldnt! need to make plans to control Dennetts body, because he would be Dennett already. As for...If you want to ram a full essay, gild it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Feild Project

Geography 1 Field Project at Whittier Narrows Whittier Narrows nature pump is a wildlife sanctuary in the San Gabriel valley in the San Gabriel river bombardment plain. It was founded in 1939 and is leased to the county of Los Angeles. It is vital to several be species, and makes a great out door classroom for critical kids to the fourth-year folks. In this essay I will signalize some(prenominal) of the plants and animals which reside in Whittier Narrows Nature Center. I will to a fault describe the sediments, earthscape and temper of this location and how they were formed. The location of Whittier Narrows is 1,000 northernernmost Durfee or latitude 34.03417, longitude -118.044361. It is situated approxi gently 360 ft above ocean level. It lays on almost 420 acres and b values the San Gabriel river. Whittier Narrows consists of 4 lakes and umteen trials. It starts from Durfee ave. on the north, Rosemead on the west, Peck rd. on the einsteinium and the San Gabr iel river (which runs dark into Seal Beach) and dam on the south. Some of the large and to a greater extent distant surroundings argon the San Gabriel mountains in the north, the Puente hills in the east, the Whittier hills in the south, and the Montebello hills in the west. The modality of Whittier Narrows along with a lot of gray California is that of a Mediterranean climate. The Mediterranean climate consists of long, hot, ironical summers, and cool wet winters. This climate is unique because it can except be found on the south westward butt against of continents like southern California, exchange Chile, the Mediterranean, the western cape, and southwest Australia. This climate covers about 3% of the Earths land and is found on the western part of continents. It is found among 30 and 45 degrees north and south of the equator. A mate old age which I visited Whittier Narrows in that location was an overcast of clouds. A few days it was partially profound (one in which I experienced some Santa Ana winds), and a ! couple other days there was a clear sky. The brave forecast was pretty...If you desire to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper

Wives Of The Dead

The Wives of The Dead The following story, the simple and domestic incidents of which may be deemed precisely worth relating, after such a expire of time, modify some degree of interest, a hundred long time ago, in a principal seaport of the Bay Province. The showery downslope of an autumn day,--a parlor on the second nucleotide of a sm all house, plainly furnished, as beseemed the mediocre circumstances of its inhabitants, merely decorated with little curiosities from beyond the sea, and a few huffy specimens of Indian manufacture,--these are the only particulars to be premised in realise to scene and season. Two young and bonnie women sat unitedly by the fireside, nursing their mutual and singular sorrows. They were the recent brides of both brothers, a sailor and a landsman, and deuce successive days had brought tidings of the death of each, by the chances of Canadian warfare and the untamed Atlantic. The universal sympathy excited by this bereavement force numerous condoling guests to the habitation of the widowed sisters. Several, among whom was the minister, had remained till the verge of even out; when, one by one, utter many comfortable passages of Scripture, that were answered by more abundant tears, they took their leave, and get out to their own happier homes. The mourners, though non insensible to the kindness of their friends, had yearned to be left(p) alone. United, as they had been, by the relationship of the living, and now more most so by that of the dead, each felt as if some(prenominal) consolation her melancholy admitted were to be found in the white meat of the other. They joined their hearts, and wept in concert silently. But after an minute of arc of such indulgence, one of the sisters, all of whose emotions were influenced by her mild, quiet, yet non feeble character, began to recollect the precepts of leniency and endurance which piety had taught her, when she did not think to need them. He r misfortune, besides, as earliest known, sh! ould earliest spare to...If you want to get a full essay, order it on our website: OrderCustomPaper.com

If you want to get a full essay, visit our page: write my paper